PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462847520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 1167aa    MW: 128148 Da    PI: 9.1968
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462847520genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.95.2e-06124180157
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                +++R  ++++ ++ +++ F+ + ++ ++e +e++  +g+t +qV+ +F  +R + +k
  462847520 124 KKPRDLLNPKAVKYMQSIFALKDTIGKKETREISVLCGVTVTQVREFFASQRSRVRK 180
                799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500718.924121181IPR001356Homeobox domain
SuperFamilySSF466893.51E-6123183IPR009057Homeodomain-like
SMARTSM003898.2E-4123185IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-5124182IPR009057Homeodomain-like
CDDcd000864.53E-4124180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1167 aa     Download sequence    Send to blast
VPSHLARVPI SFLLLAPHLQ TLTPPRRRPP PRHHTAQQKG QPDAQPPVGP MELVAFKPAV  60
GALVEAGGGA DAGSIPAMVA AQQEMLHTQV DQLQSLVITQ CRLTGVNPLA QEMAAGALSI  120
KIGKKPRDLL NPKAVKYMQS IFALKDTIGK KETREISVLC GVTVTQVREF FASQRSRVRK  180
VVNLSREKVL KIEAPKEHHD ACSITTEQTP LDIEARAEII EPLRTLGPVE VPRSSSQPTD  240
VPQFYLQPVL VQQSSLQPTD ALQNSLQQLE VQQNHAAPII PSGTILMQPT DAKINPDSVQ  300
KESKEEEVPG VESEDKKFFD SIFALTQKEE TFSGQVKLMD WILQINNITI LSWFVTMGGL  360
TIVSAWLSQA AVEEQTSVIL VIFKVLLHLP LHKALPAHMS TVLQTINRLR FYRTQDISSK  420
AKIILSRLSK VLVRSKALRM PQKDLTEKQR ISEILGDESW KSEVGITEEI LALTDGANEN  480
RKPEPRKTPM LLTASADEPS KKSAPQTKSK QKRKVLLVEH PNKKAAGKSA HSVRSISTNN  540
SRPLSADDIQ KAKMRAMFMQ EKYGKVDTGK ASDKLQTMET QKSSGFHNSI VPPLPKSPVT  600
STTKEPVDLS PQTSKQSTVP QTDKAETTDG LKLKISSPKH VIEKLDSKRV LWQIPPAVWI  660
DPSWSVGAGE NSKELEVQTQ RNRREKETFY ANQRDIPLNP KDPWDLEMDF DDSLTPEIPI  720
EQQPDADNME TDTVGTAPPA TNPQLVFALT SNKGESVPSE QTIALLDTLK RTGLELSDLV  780
NNLANGAAVA PKGPPQPEPV PTSLPSPTPA SDHTAMAGWG PEHPTQARAP SVQHPQSSNR  840
GHTPPIGNTV QQSFSNVVSP LPSQPYASVS VLPAQNQMNV PSLPQLATSV NPPIQHVSPV  900
NNHPNRASVH QHAQQYALVS DPVATSFHQQ PAVNKVTHGL ENISNPAVAH ASMPESNACH  960
TTFPWQSNVA PVASTGRGTS PDPWAVRTTN SYNIASTNTV PYANQNFYGN HSAQNGQGAY  1020
GSVSVSSHAV LPAHTPDRNG YSHPAEYQTL SRDSYRRHSK SPELVGSGHD YGGTQGYNAR  1080
TWNGAGQQSY NPEPSRQLIS ARQSYTAAEP SRQQWSSGHE SYNFEPSRPW SSSQQGQNPE  1140
TSRPWNLGNQ DHYNPNDVRR SYDRWRR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1766771DTLKRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971183.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-103LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLK3XDW20.0K3XDW2_SETIT; Uncharacterized protein
STRINGSi000079m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80433034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-95HB-other family protein